Loading...
Statistics
Advertisement

Enaoz.com

Home Conversion Technology Metas Server
Enaoz.com is hosted in United States / San Francisco . Enaoz.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: cloudflare-nginx.

Technologies in use by Enaoz.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • cloudflare-nginx

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Enaoz.com

Missing HTTPS protocol.

    Meta - Enaoz.com

    Number of occurences: 1
    • Name:
      Content: 0;URL=/cgi-sys/defaultwebpage.cgi

    Server / Hosting

    • IP: 104.28.18.27
    • Latitude: 37.77
    • Longitude: -122.39
    • Country: United States
    • City: San Francisco

    Rname

    • seth.ns.cloudflare.com
    • rose.ns.cloudflare.com
    • enaoz.com

    Target

    • dns.cloudflare.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Tue, 19 Jul 2016 18:14:45 GMT Content-Type: text/html Set-Cookie: __cfduid=d8b0d857a9527d01673c700fd6b7130571468952085; expires=Wed, 19-Jul-17 18:14:45 GMT; path=/; domain=.enaoz.com; HttpOnly Last-Modified: Sun, 26 Jun 2016 18:41:20 GMT Vary: Accept-Encoding,User-Agent Cache-Control: max-age=315360000 Expires: Fri, 17 Jul 2026 18:14:45 GMT Server: cloudflare-nginx CF-RAY: 2c5027a3ac5d2120-LAX X-Cache: MISS from s_fl413 X-Cache-Lookup: MISS from s_fl413:80 Transfer-Encoding: chunked Via: 1.1 s_fl413 (squid/3.5.19) Connection: keep-alive

    DNS

    host: enaoz.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 104.28.19.27
    host: enaoz.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 104.28.18.27
    host: enaoz.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: seth.ns.cloudflare.com
    host: enaoz.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: rose.ns.cloudflare.com
    host: enaoz.com
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: rose.ns.cloudflare.com
    5. rname: dns.cloudflare.com
    6. serial: 2022034880
    7. refresh: 10000
    8. retry: 2400
    9. expire: 604800
    10. minimum-ttl: 3600
    host: enaoz.com
    1. class: IN
    2. ttl: 300
    3. type: MX
    4. pri: 0
    5. target: enaoz.com
    host: enaoz.com
    1. class: IN
    2. ttl: 300
    3. type: TXT
    4. txt: v=spf1 +a +mx +ip4:204.197.255.131 ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.naoz.com, www.exnaoz.com, www.xnaoz.com, www.esnaoz.com, www.snaoz.com, www.ewnaoz.com, www.wnaoz.com, www.ernaoz.com, www.rnaoz.com, www.efnaoz.com, www.fnaoz.com, www.evnaoz.com, www.vnaoz.com, www.ecnaoz.com, www.cnaoz.com, www.eqnaoz.com, www.qnaoz.com, www.eanaoz.com, www.anaoz.com, www.eynaoz.com, www.ynaoz.com, www.eaoz.com, www.ennaoz.com, www.enaoz.com, www.enhaoz.com, www.ehaoz.com, www.enjaoz.com, www.ejaoz.com, www.enkaoz.com, www.ekaoz.com, www.enlaoz.com, www.elaoz.com, www.en aoz.com, www.e aoz.com, www.enoz.com, www.enaooz.com, www.enooz.com, www.enapoz.com, www.enpoz.com, www.ena9oz.com, www.en9oz.com, www.enaoz.com, www.enoz.com, www.enaioz.com, www.enioz.com, www.enauoz.com, www.enuoz.com, www.enaz.com, www.enaobz.com, www.enabz.com, www.enaohz.com, www.enahz.com, www.enaogz.com, www.enagz.com, www.enaojz.com, www.enajz.com, www.enaomz.com, www.enamz.com, www.enao z.com, www.ena z.com, www.enaovz.com, www.enavz.com, www.enao.com, www.enaozt.com, www.enaot.com, www.enaoza.com, www.enaoa.com, www.enaozs.com, www.enaos.com, www.enaozx.com, www.enaox.com, www.enaozc.com, www.enaoc.com, www.enaozg.com, www.enaog.com, www.enaozh.com, www.enaoh.com, www.enaozj.com, www.enaoj.com, www.enaozu.com, www.enaou.com,

    Other Reviews

    1. The Windsor Dental Center with Dr. Steven P. Stern
      Dr. Steven Stern of Windsor Dental Center is a professional dedicated to Excellence in General, Family, & Cosmetic Dentistry such as Dental Makeovers, Porcelain Veneers, Teeth Whitening, Crowns/Caps & many other dental procedures. Please come and visit Windsor Dental Center, in New Windsor, NY.
      United States - 8.19.178.140
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, jQuery, jQuery Cookie, Php, Google Analytics
      Number of Javascript: 12
      Number of meta tags: 6
    2. GABLESCLUB
      Englewood (United States) - 204.200.222.174
      Server software: Apache/1.3.42 Ben-SSL/1.60 (Unix) mod_perl/1.30 FrontPage/5.0.2.2624
      Technology: Html
      Number of meta tags: 1
    3. emergencyrepairandweldingservice.com - Portable Rig Welding Services
      Portable Rig Welding Services
      Burnaby (Canada) - 69.161.143.73
      G Analytics ID: UA-52100612-1
      Server software: Apache
      Technology: CSS, Html, Javascript, Google Analytics
      Number of meta tags: 6
    4. Art Fusion Möbel
      Shop powered by PrestaShop
      Germany - 81.169.145.93
      G Analytics ID: UA-58828347-1
      Server software: Apache/2.2.15 (CentOS)
      Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, Google Analytics
      Number of Javascript: 22
      Number of meta tags: 8
    5. artismundus.com
      New York (United States) - 69.172.201.153
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    6. Barbara Koedel Fotografie
      Germany - 217.160.233.77
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    7. QUBE - Better Buildings
      QUBE - Better Buildings
      Provo (United States) - 69.89.31.141
      Server software: nginx/1.10.1
      Technology: AJAX Libraries API, CSS, Html, Html5, Javascript, jQuery Cycle, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 4
    8. The Ultimate Source of Telecommunication Products and Services -
      Scottsdale (United States) - 50.63.111.1
      Server software: Apache
      Technology: CSS, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
      Number of Javascript: 17
      Number of meta tags: 6
    9. Boardreader - Forum Search Engine
      Boardreader is search engine for Forums and Boards. Get fast and quality search for your own forum.
      Troy (United States) - 208.92.218.173
      Server software: Apache
      Technology: CSS, Html, Javascript, Php, Pingdom
      Number of Javascript: 5
      Number of meta tags: 3